Recombinant Bacillus subtilis Glycine oxidase (thiO), Unconjugated, E. coli

Artikelnummer: BIM-RPC22892
Artikelname: Recombinant Bacillus subtilis Glycine oxidase (thiO), Unconjugated, E. coli
Artikelnummer: BIM-RPC22892
Hersteller Artikelnummer: RPC22892
Alternativnummer: BIM-RPC22892-20UG,BIM-RPC22892-100UG,BIM-RPC22892-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: thiO, goxB, yjbR, BSU11670Glycine oxidase, GO, EC 1.4.3.19
Recombinant Bacillus subtilis Glycine oxidase (thiO) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: thiO. Target Synonyms: thiO, goxB, yjbR, BSU11670Glycine oxidase, GO, EC 1.4.3.19. Accession Number: O31616. Expression Region: 1~369aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 56.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 56.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MKRHYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMGGRTTSAAAGMLGAHAECEERDAFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFKLAFSEEDVLQLRQMDDLDSVSWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDIPLTKTLYHDHCYIVPRKSGRL
Target-Kategorie: thiO