Recombinant Bacillus subtilis Glycine oxidase (thiO), Unconjugated, E. coli

Catalog Number: BIM-RPC22892
Article Name: Recombinant Bacillus subtilis Glycine oxidase (thiO), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22892
Supplier Catalog Number: RPC22892
Alternative Catalog Number: BIM-RPC22892-20UG,BIM-RPC22892-100UG,BIM-RPC22892-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: thiO, goxB, yjbR, BSU11670Glycine oxidase, GO, EC 1.4.3.19
Recombinant Bacillus subtilis Glycine oxidase (thiO) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: thiO. Target Synonyms: thiO, goxB, yjbR, BSU11670Glycine oxidase, GO, EC 1.4.3.19. Accession Number: O31616. Expression Region: 1~369aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 56.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 56.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MKRHYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMGGRTTSAAAGMLGAHAECEERDAFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFKLAFSEEDVLQLRQMDDLDSVSWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDIPLTKTLYHDHCYIVPRKSGRL
Target: thiO