Recombinant Arabidopsis thaliana Polyadenylate-binding protein RBP47A (RBP47A), Unconjugated, E. coli

Artikelnummer: BIM-RPC22896
Artikelname: Recombinant Arabidopsis thaliana Polyadenylate-binding protein RBP47A (RBP47A), Unconjugated, E. coli
Artikelnummer: BIM-RPC22896
Hersteller Artikelnummer: RPC22896
Alternativnummer: BIM-RPC22896-20UG,BIM-RPC22896-100UG,BIM-RPC22896-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: A. thaliana
Konjugation: Unconjugated
Alternative Synonym: RNA-binding protein 47A
Recombinant Arabidopsis thaliana Polyadenylate-binding protein RBP47A (RBP47A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: RBP47A. Target Synonyms: RNA-binding protein 47A. Accession Number: F4I3B3. Expression Region: 1~445aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 53.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 53.5kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MQTPNNNGSTDSVLPPTSAGTTPPPPLQQSTPPPQQQQQQQWQQQQQWMAAMQQYPAAAMAMMQQQQMMMYPHPQYAPYNQAAYQQHPQFQYAAYQQQQQQHHQSQQQPRGGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSK
Target-Kategorie: RBP47A