Recombinant Arabidopsis thaliana Polyadenylate-binding protein RBP47A (RBP47A), Unconjugated, E. coli

Catalog Number: BIM-RPC22896
Article Name: Recombinant Arabidopsis thaliana Polyadenylate-binding protein RBP47A (RBP47A), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22896
Supplier Catalog Number: RPC22896
Alternative Catalog Number: BIM-RPC22896-20UG,BIM-RPC22896-100UG,BIM-RPC22896-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Conjugation: Unconjugated
Alternative Names: RNA-binding protein 47A
Recombinant Arabidopsis thaliana Polyadenylate-binding protein RBP47A (RBP47A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: RBP47A. Target Synonyms: RNA-binding protein 47A. Accession Number: F4I3B3. Expression Region: 1~445aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 53.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 53.5kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MQTPNNNGSTDSVLPPTSAGTTPPPPLQQSTPPPQQQQQQQWQQQQQWMAAMQQYPAAAMAMMQQQQMMMYPHPQYAPYNQAAYQQHPQFQYAAYQQQQQQHHQSQQQPRGGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSK
Target: RBP47A