Recombinant Schizosaccharomyces pombe Glucan endo-1, 3-alpha-glucosidase agn1 (agn1), Unconjugated, E. coli

Artikelnummer: BIM-RPC22897
Artikelname: Recombinant Schizosaccharomyces pombe Glucan endo-1, 3-alpha-glucosidase agn1 (agn1), Unconjugated, E. coli
Artikelnummer: BIM-RPC22897
Hersteller Artikelnummer: RPC22897
Alternativnummer: BIM-RPC22897-20UG,BIM-RPC22897-100UG,BIM-RPC22897-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Fungi
Konjugation: Unconjugated
Alternative Synonym: Endo-1,3-alpha-glucanase agn1
Recombinant Schizosaccharomyces pombe Glucan endo-1, 3-alpha-glucosidase agn1 (agn1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: SchizosaccharoMyces pombe (strain 972 / ATCC 24843) (Fission yeast). Target Name: agn1. Target Synonyms: Endo-1,3-alpha-glucanase agn1. Accession Number: O13716. Expression Region: 21~424aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 51.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 51.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: DKMVVAHFIVGNTYPYTVSNWEEDIQDAIAVGIDGFALNMGSDAWQVERIEDAYDAAASVSSDFKLFISFDMSIISADADFIEGVVRRFADKPNQLYYDGKVFVSTFAGETDTFGYSDVSTGWDSAVKEPLASAGYPIYFVPSWTSLGQGALEESVADGFLSWNAWPTTDADMNDNDDIGYQNLANSLGKLYVAPVSPWFYTHLSYKNWAYKSDWLIIDRWNEMLSVQPDMIEVLTWNDYGESHYIGNIQGALPA
Target-Kategorie: agn1