Recombinant Schizosaccharomyces pombe Glucan endo-1, 3-alpha-glucosidase agn1 (agn1), Unconjugated, E. coli

Catalog Number: BIM-RPC22897
Article Name: Recombinant Schizosaccharomyces pombe Glucan endo-1, 3-alpha-glucosidase agn1 (agn1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22897
Supplier Catalog Number: RPC22897
Alternative Catalog Number: BIM-RPC22897-20UG,BIM-RPC22897-100UG,BIM-RPC22897-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Alternative Names: Endo-1,3-alpha-glucanase agn1
Recombinant Schizosaccharomyces pombe Glucan endo-1, 3-alpha-glucosidase agn1 (agn1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: SchizosaccharoMyces pombe (strain 972 / ATCC 24843) (Fission yeast). Target Name: agn1. Target Synonyms: Endo-1,3-alpha-glucanase agn1. Accession Number: O13716. Expression Region: 21~424aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 51.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 51.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: DKMVVAHFIVGNTYPYTVSNWEEDIQDAIAVGIDGFALNMGSDAWQVERIEDAYDAAASVSSDFKLFISFDMSIISADADFIEGVVRRFADKPNQLYYDGKVFVSTFAGETDTFGYSDVSTGWDSAVKEPLASAGYPIYFVPSWTSLGQGALEESVADGFLSWNAWPTTDADMNDNDDIGYQNLANSLGKLYVAPVSPWFYTHLSYKNWAYKSDWLIIDRWNEMLSVQPDMIEVLTWNDYGESHYIGNIQGALPA
Target: agn1