Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2 (clpP2), Unconjugated, E. coli

Artikelnummer: BIM-RPC22924
Artikelname: Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2 (clpP2), Unconjugated, E. coli
Artikelnummer: BIM-RPC22924
Hersteller Artikelnummer: RPC22924
Alternativnummer: BIM-RPC22924-20UG,BIM-RPC22924-100UG,BIM-RPC22924-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Endopeptidase Clp 2
Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2 (clpP2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680). Target Name: clpP2. Target Synonyms: Endopeptidase Clp 2. Accession Number: O51698. Expression Region: 1~198aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MTGKEDNDACVLHDKSLKLVLKSRSIVIAGEITKDVSRLFQEKILLLEALDFKKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTVGVGLVASAAALIFLAAKLENRFSLPFARYLLHQPLSGFKGVATDIEIYTNELNKVKKELNNIISKETGQKISKIEKDTDRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA
Target-Kategorie: clpP2