Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2 (clpP2), Unconjugated, E. coli

Catalog Number: BIM-RPC22924
Article Name: Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2 (clpP2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22924
Supplier Catalog Number: RPC22924
Alternative Catalog Number: BIM-RPC22924-20UG,BIM-RPC22924-100UG,BIM-RPC22924-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Endopeptidase Clp 2
Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2 (clpP2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680). Target Name: clpP2. Target Synonyms: Endopeptidase Clp 2. Accession Number: O51698. Expression Region: 1~198aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MTGKEDNDACVLHDKSLKLVLKSRSIVIAGEITKDVSRLFQEKILLLEALDFKKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTVGVGLVASAAALIFLAAKLENRFSLPFARYLLHQPLSGFKGVATDIEIYTNELNKVKKELNNIISKETGQKISKIEKDTDRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA
Target: clpP2