Recombinant Colwellia psychrerythraea DNA ligase (ligA), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC23096
Artikelname: Recombinant Colwellia psychrerythraea DNA ligase (ligA), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC23096
Hersteller Artikelnummer: RPC23096
Alternativnummer: BIM-RPC23096-20UG,BIM-RPC23096-100UG,BIM-RPC23096-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Polydeoxyribonucleotide synthase [NAD(+)]
Recombinant Colwellia psychrerythraea DNA ligase (ligA), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus). Target Name: ligA. Target Synonyms: Polydeoxyribonucleotide synthase [NAD(+)]. Accession Number: Q47YI0. Expression Region: 330~689aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 42.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.1kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: KFPAEEELTCVEDVEFQVGRTGAITPVARLKPVFVGGVTVSNATLHNQDEITRLGLKVNDFVVIRRAGDVIPQIVSVVLDKRPDNAVDIVFPTSCPVCDSAVAKPEGEAVLRCTAGLFCAAQRKEAIKHFASRKAHDVDGLGDKLVEQLVDEKLINTPADLFKLTEIQVSTIDRMGKKSATNLINGLEQAKSTTLAKFIYGLGIREVGEATAANLANHFYTLAAIESASLEDLQNVSDVGEVVAKNIINFFKEEH
Target-Kategorie: ligA