Recombinant Colwellia psychrerythraea DNA ligase (ligA), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC23096
Article Name: Recombinant Colwellia psychrerythraea DNA ligase (ligA), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23096
Supplier Catalog Number: RPC23096
Alternative Catalog Number: BIM-RPC23096-20UG,BIM-RPC23096-100UG,BIM-RPC23096-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Polydeoxyribonucleotide synthase [NAD(+)]
Recombinant Colwellia psychrerythraea DNA ligase (ligA), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus). Target Name: ligA. Target Synonyms: Polydeoxyribonucleotide synthase [NAD(+)]. Accession Number: Q47YI0. Expression Region: 330~689aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 42.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.1kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: KFPAEEELTCVEDVEFQVGRTGAITPVARLKPVFVGGVTVSNATLHNQDEITRLGLKVNDFVVIRRAGDVIPQIVSVVLDKRPDNAVDIVFPTSCPVCDSAVAKPEGEAVLRCTAGLFCAAQRKEAIKHFASRKAHDVDGLGDKLVEQLVDEKLINTPADLFKLTEIQVSTIDRMGKKSATNLINGLEQAKSTTLAKFIYGLGIREVGEATAANLANHFYTLAAIESASLEDLQNVSDVGEVVAKNIINFFKEEH
Target: ligA