Recombinant Human Single-strand selective monofunctional uracil DNA glycosylase (SMUG1), Unconjugated, E. coli

Artikelnummer: BIM-RPC23130
Artikelname: Recombinant Human Single-strand selective monofunctional uracil DNA glycosylase (SMUG1), Unconjugated, E. coli
Artikelnummer: BIM-RPC23130
Hersteller Artikelnummer: RPC23130
Alternativnummer: BIM-RPC23130-20UG,BIM-RPC23130-100UG,BIM-RPC23130-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: FDG, HMUDG, MGC104370, Single strand selective monofunctional uracil DNA glycosylase 1, Single strand selective monofunctional uracil DNA glycosylase, Single-strand selective monofunctional uracil DNA glycosylase, SMUG 1, Smug1, SMUG1 protein, SMUG1_HUMAN, UNG 3, UNG3
Recombinant Human Single-strand selective monofunctional uracil DNA glycosylase (SMUG1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SMUG1. Target Synonyms: FDG, HMUDG, MGC104370, Single strand selective monofunctional uracil DNA glycosylase 1, Single strand selective monofunctional uracil DNA glycosylase, Single-strand selective monofunctional uracil DNA glycosylase. Accession Number: Q53HV7. Expression Region: 1~177aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 35.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 35.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL
Target-Kategorie: SMUG1