Recombinant Human Single-strand selective monofunctional uracil DNA glycosylase (SMUG1), Unconjugated, E. coli

Catalog Number: BIM-RPC23130
Article Name: Recombinant Human Single-strand selective monofunctional uracil DNA glycosylase (SMUG1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23130
Supplier Catalog Number: RPC23130
Alternative Catalog Number: BIM-RPC23130-20UG,BIM-RPC23130-100UG,BIM-RPC23130-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: FDG, HMUDG, MGC104370, Single strand selective monofunctional uracil DNA glycosylase 1, Single strand selective monofunctional uracil DNA glycosylase, Single-strand selective monofunctional uracil DNA glycosylase, SMUG 1, Smug1, SMUG1 protein, SMUG1_HUMAN, UNG 3, UNG3
Recombinant Human Single-strand selective monofunctional uracil DNA glycosylase (SMUG1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SMUG1. Target Synonyms: FDG, HMUDG, MGC104370, Single strand selective monofunctional uracil DNA glycosylase 1, Single strand selective monofunctional uracil DNA glycosylase, Single-strand selective monofunctional uracil DNA glycosylase. Accession Number: Q53HV7. Expression Region: 1~177aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 35.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 35.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL
Target: SMUG1