Recombinant Mouse Adiponectin (Adipoq), Unconjugated, E. coli

Artikelnummer: BIM-RPC23167
Artikelname: Recombinant Mouse Adiponectin (Adipoq), Unconjugated, E. coli
Artikelnummer: BIM-RPC23167
Hersteller Artikelnummer: RPC23167
Alternativnummer: BIM-RPC23167-20UG,BIM-RPC23167-100UG,BIM-RPC23167-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, ACRP30Adipocyte, C1q and collagen domain-containing protein, Adipocyte-specific protein AdipoQ
Recombinant Mouse Adiponectin (Adipoq) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Adipoq. Target Synonyms: 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, ACRP30Adipocyte, C1q and collagen domain-containing protein, Adipocyte-specific protein AdipoQ. Accession Number: Q60994. Expression Region: 18~247aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Target-Kategorie: Adipoq