Recombinant Mouse Adiponectin (Adipoq), Unconjugated, E. coli

Catalog Number: BIM-RPC23167
Article Name: Recombinant Mouse Adiponectin (Adipoq), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23167
Supplier Catalog Number: RPC23167
Alternative Catalog Number: BIM-RPC23167-20UG,BIM-RPC23167-100UG,BIM-RPC23167-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, ACRP30Adipocyte, C1q and collagen domain-containing protein, Adipocyte-specific protein AdipoQ
Recombinant Mouse Adiponectin (Adipoq) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Adipoq. Target Synonyms: 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, ACRP30Adipocyte, C1q and collagen domain-containing protein, Adipocyte-specific protein AdipoQ. Accession Number: Q60994. Expression Region: 18~247aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 28.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Target: Adipoq