Recombinant Human Endogenous retrovirus group K member 6 Env polyprotein (ERVK-6), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC23169
Artikelname: Recombinant Human Endogenous retrovirus group K member 6 Env polyprotein (ERVK-6), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC23169
Hersteller Artikelnummer: RPC23169
Alternativnummer: BIM-RPC23169-20UG,BIM-RPC23169-100UG,BIM-RPC23169-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: EnvK2 proteinEnvelope polyproteinHERV-K(C7) envelope proteinHERV-K(HML-2.HOM) envelope proteinHERV-K108 envelope proteinHERV-K_7p22.1 provirus ancestral Env polyproteinCleaved into the following 2 chains:Surface proteinSUTransmembrane proteinTM
Recombinant Human Endogenous retrovirus group K member 6 Env polyprotein (ERVK-6), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ERVK-6. Target Synonyms: EnvK2 proteinEnvelope polyproteinHERV-K(C7) envelope proteinHERV-K(HML-2.HOM) envelope proteinHERV-K108 envelope proteinHERV-K_7p22.1 provirus ancestral Env polyprotein. Accession Number: Q69384. Expression Region: 90~632aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 77.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 77.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: LPMPAGAAAANYTYWAYVPFPPLIRAVTWMDNPTEVYVNDSVWVPGPIDDRCPAKPEEEGMMINISIGYHYPPICLGRAPGCLMPAVQNWLVEVPTVSPICRFTYHMVSGMSLRPRVNYLQDFSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSAVILQNNEFGTIIDWAPRGQFYHNCSGQTQSCPSAQVSPAVDSDLTESLDKHKHKKLQSFYPWEWGEKGISTPRPKIVSPVSGPEHPELWRLTV
Target-Kategorie: ERVK-6