Recombinant Human Endogenous retrovirus group K member 6 Env polyprotein (ERVK-6), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC23169
Article Name: Recombinant Human Endogenous retrovirus group K member 6 Env polyprotein (ERVK-6), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23169
Supplier Catalog Number: RPC23169
Alternative Catalog Number: BIM-RPC23169-20UG,BIM-RPC23169-100UG,BIM-RPC23169-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: EnvK2 proteinEnvelope polyproteinHERV-K(C7) envelope proteinHERV-K(HML-2.HOM) envelope proteinHERV-K108 envelope proteinHERV-K_7p22.1 provirus ancestral Env polyproteinCleaved into the following 2 chains:Surface proteinSUTransmembrane proteinTM
Recombinant Human Endogenous retrovirus group K member 6 Env polyprotein (ERVK-6), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ERVK-6. Target Synonyms: EnvK2 proteinEnvelope polyproteinHERV-K(C7) envelope proteinHERV-K(HML-2.HOM) envelope proteinHERV-K108 envelope proteinHERV-K_7p22.1 provirus ancestral Env polyprotein. Accession Number: Q69384. Expression Region: 90~632aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 77.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 77.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: LPMPAGAAAANYTYWAYVPFPPLIRAVTWMDNPTEVYVNDSVWVPGPIDDRCPAKPEEEGMMINISIGYHYPPICLGRAPGCLMPAVQNWLVEVPTVSPICRFTYHMVSGMSLRPRVNYLQDFSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSAVILQNNEFGTIIDWAPRGQFYHNCSGQTQSCPSAQVSPAVDSDLTESLDKHKHKKLQSFYPWEWGEKGISTPRPKIVSPVSGPEHPELWRLTV
Target: ERVK-6