Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7/L12 (rplL), Unconjugated, E. coli

Artikelnummer: BIM-RPC23179
Artikelname: Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7/L12 (rplL), Unconjugated, E. coli
Artikelnummer: BIM-RPC23179
Hersteller Artikelnummer: RPC23179
Alternativnummer: BIM-RPC23179-20UG,BIM-RPC23179-100UG,BIM-RPC23179-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: rplL, M6_Spy0814, 50S ribosomal protein L7/L12
Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7/L12 (rplL) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394). Target Name: rplL. Target Synonyms: rplL, M6_Spy0814, 50S ribosomal protein L7/L12. Accession Number: Q5XCB4. Expression Region: 1~121aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.3kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAAAAGGAEEAAKDSFDVELTSAGDKKVGVIKAVREITGLGLKEAKGLVDGAPANVKEGVAAAEAEEIKAKLEEAGATITLK
Target-Kategorie: rplL