Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7/L12 (rplL), Unconjugated, E. coli

Catalog Number: BIM-RPC23179
Article Name: Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7/L12 (rplL), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23179
Supplier Catalog Number: RPC23179
Alternative Catalog Number: BIM-RPC23179-20UG,BIM-RPC23179-100UG,BIM-RPC23179-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: rplL, M6_Spy0814, 50S ribosomal protein L7/L12
Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7/L12 (rplL) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394). Target Name: rplL. Target Synonyms: rplL, M6_Spy0814, 50S ribosomal protein L7/L12. Accession Number: Q5XCB4. Expression Region: 1~121aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 32.3kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAAAAGGAEEAAKDSFDVELTSAGDKKVGVIKAVREITGLGLKEAKGLVDGAPANVKEGVAAAEAEEIKAKLEEAGATITLK
Target: rplL