Recombinant Zaire ebolavirus Matrix protein VP40 (VP40), Unconjugated, E. coli

Artikelnummer: BIM-RPC23245
Artikelname: Recombinant Zaire ebolavirus Matrix protein VP40 (VP40), Unconjugated, E. coli
Artikelnummer: BIM-RPC23245
Hersteller Artikelnummer: RPC23245
Alternativnummer: BIM-RPC23245-20UG,BIM-RPC23245-100UG,BIM-RPC23245-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Membrane-associated protein VP40
Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus). Target Name: VP40. Target Synonyms: Membrane-associated protein VP40. Accession Number: Q77DJ6. Expression Region: 1~326AA. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 51.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 51.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPT
Target-Kategorie: VP40