Recombinant Zaire ebolavirus Matrix protein VP40 (VP40), Unconjugated, E. coli

Catalog Number: BIM-RPC23245
Article Name: Recombinant Zaire ebolavirus Matrix protein VP40 (VP40), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23245
Supplier Catalog Number: RPC23245
Alternative Catalog Number: BIM-RPC23245-20UG,BIM-RPC23245-100UG,BIM-RPC23245-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Membrane-associated protein VP40
Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus). Target Name: VP40. Target Synonyms: Membrane-associated protein VP40. Accession Number: Q77DJ6. Expression Region: 1~326AA. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 51.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 51.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPT
Target: VP40