Recombinant Enterococcus faecalis Gelatinase (gelE), Unconjugated, E. coli

Artikelnummer: BIM-RPC23258
Artikelname: Recombinant Enterococcus faecalis Gelatinase (gelE), Unconjugated, E. coli
Artikelnummer: BIM-RPC23258
Hersteller Artikelnummer: RPC23258
Alternativnummer: BIM-RPC23258-20UG,BIM-RPC23258-100UG,BIM-RPC23258-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Coccolysin
Recombinant Enterococcus faecalis Gelatinase (gelE) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterococcus faecalis (strain ATCC 700802 / V583). Target Name: gelE. Target Synonyms: Coccolysin. Accession Number: Q833V7. Expression Region: 193~510aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 50.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 47.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: VGSEVTLKNSFQVAFNVPVEKSNTGIALHGTDNTGVYHAVVDGKNNYSIIQAPSLVALNQNAVDAYTHGKFVKTYYEDHFQRHSIDDRGMPILSVVDEQHPDAYDNAFWDGKAMRYGETSTPTGKTYASSLDVVGHEMTHGVTEHTAGLEYLGQSGALNESYSDLMGYIISGASNPEIGADTQSVDRKTGIRNLQTPSKHGQPETMAQYDDRARYKGTPYYDQGGVHYNSGIINRIGYTIIQNLGIEKAQTIFYS
Target-Kategorie: gelE