Recombinant Enterococcus faecalis Gelatinase (gelE), Unconjugated, E. coli

Catalog Number: BIM-RPC23258
Article Name: Recombinant Enterococcus faecalis Gelatinase (gelE), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23258
Supplier Catalog Number: RPC23258
Alternative Catalog Number: BIM-RPC23258-20UG,BIM-RPC23258-100UG,BIM-RPC23258-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Coccolysin
Recombinant Enterococcus faecalis Gelatinase (gelE) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterococcus faecalis (strain ATCC 700802 / V583). Target Name: gelE. Target Synonyms: Coccolysin. Accession Number: Q833V7. Expression Region: 193~510aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 50.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 47.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: VGSEVTLKNSFQVAFNVPVEKSNTGIALHGTDNTGVYHAVVDGKNNYSIIQAPSLVALNQNAVDAYTHGKFVKTYYEDHFQRHSIDDRGMPILSVVDEQHPDAYDNAFWDGKAMRYGETSTPTGKTYASSLDVVGHEMTHGVTEHTAGLEYLGQSGALNESYSDLMGYIISGASNPEIGADTQSVDRKTGIRNLQTPSKHGQPETMAQYDDRARYKGTPYYDQGGVHYNSGIINRIGYTIIQNLGIEKAQTIFYS
Target: gelE