Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC23263
Artikelname: Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC23263
Hersteller Artikelnummer: RPC23263
Alternativnummer: BIM-RPC23263-20UG,BIM-RPC23263-100UG,BIM-RPC23263-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Porcine
Konjugation: Unconjugated
Alternative Synonym: CD_antigen: CD124
Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: IL4R. Target Synonyms: CD_antigen: CD124. Accession Number: Q863Z5. Expression Region: 33~240aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR
Target-Kategorie: IL4R