Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC23263
Article Name: Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23263
Supplier Catalog Number: RPC23263
Alternative Catalog Number: BIM-RPC23263-20UG,BIM-RPC23263-100UG,BIM-RPC23263-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Porcine
Conjugation: Unconjugated
Alternative Names: CD_antigen: CD124
Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: IL4R. Target Synonyms: CD_antigen: CD124. Accession Number: Q863Z5. Expression Region: 33~240aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 28.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR
Target: IL4R