Recombinant Mouse BAG family molecular chaperone regulator 3 (Bag3), Unconjugated, E. coli

Artikelnummer: BIM-RPC23562
Artikelname: Recombinant Mouse BAG family molecular chaperone regulator 3 (Bag3), Unconjugated, E. coli
Artikelnummer: BIM-RPC23562
Hersteller Artikelnummer: RPC23562
Alternativnummer: BIM-RPC23562-20UG,BIM-RPC23562-100UG,BIM-RPC23562-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Bcl-2-associated athanogene 3Bcl-2-binding protein Bis
Recombinant Mouse BAG family molecular chaperone regulator 3 (Bag3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Bag3. Target Synonyms: Bcl-2-associated athanogene 3Bcl-2-binding protein Bis. Accession Number: Q9JLV1. Expression Region: 2~577aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 77.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 77.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SAATQSPMMQMASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKDTASSANGPSRDGSRLLPIREGHPIYPQLRPGYIPIPVLHEGSENRQPHLFHAYSQPGVQRFRTEAAAATPQRSQSPLRGGMTEAAQTDKQCGQMPATATTAAAQPPTAHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRPAAQPSFHQAQKTHYPAQQGEYQPQQPVYHKI
Target-Kategorie: Bag3