Recombinant Mouse BAG family molecular chaperone regulator 3 (Bag3), Unconjugated, E. coli

Catalog Number: BIM-RPC23562
Article Name: Recombinant Mouse BAG family molecular chaperone regulator 3 (Bag3), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23562
Supplier Catalog Number: RPC23562
Alternative Catalog Number: BIM-RPC23562-20UG,BIM-RPC23562-100UG,BIM-RPC23562-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Bcl-2-associated athanogene 3Bcl-2-binding protein Bis
Recombinant Mouse BAG family molecular chaperone regulator 3 (Bag3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Bag3. Target Synonyms: Bcl-2-associated athanogene 3Bcl-2-binding protein Bis. Accession Number: Q9JLV1. Expression Region: 2~577aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 77.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 77.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SAATQSPMMQMASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKDTASSANGPSRDGSRLLPIREGHPIYPQLRPGYIPIPVLHEGSENRQPHLFHAYSQPGVQRFRTEAAAATPQRSQSPLRGGMTEAAQTDKQCGQMPATATTAAAQPPTAHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRPAAQPSFHQAQKTHYPAQQGEYQPQQPVYHKI
Target: Bag3