Recombinant Bacillus halodurans Putative adenine deaminase BH0637 (BH0637), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC23563
Artikelname: Recombinant Bacillus halodurans Putative adenine deaminase BH0637 (BH0637), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC23563
Hersteller Artikelnummer: RPC23563
Alternativnummer: BIM-RPC23563-20UG,BIM-RPC23563-100UG,BIM-RPC23563-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: BH0637, Putative adenine deaminase BH0637, Adenase, Adenine aminase, EC 3.5.4.2
Recombinant Bacillus halodurans Putative adenine deaminase BH0637 (BH0637), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125). Target Name: BH0637. Target Synonyms: BH0637, Putative adenine deaminase BH0637, Adenase, Adenine aminase, EC 3.5.4.2. Accession Number: Q9KF49. Expression Region: 1~328aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 57.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 57.7kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWIYQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSFANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDPQTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTLTQMSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHS
Target-Kategorie: BH0637