Recombinant Bacillus halodurans Putative adenine deaminase BH0637 (BH0637), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC23563
Article Name: Recombinant Bacillus halodurans Putative adenine deaminase BH0637 (BH0637), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23563
Supplier Catalog Number: RPC23563
Alternative Catalog Number: BIM-RPC23563-20UG,BIM-RPC23563-100UG,BIM-RPC23563-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: BH0637, Putative adenine deaminase BH0637, Adenase, Adenine aminase, EC 3.5.4.2
Recombinant Bacillus halodurans Putative adenine deaminase BH0637 (BH0637), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125). Target Name: BH0637. Target Synonyms: BH0637, Putative adenine deaminase BH0637, Adenase, Adenine aminase, EC 3.5.4.2. Accession Number: Q9KF49. Expression Region: 1~328aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 57.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 57.7kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWIYQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSFANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDPQTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTLTQMSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHS
Target: BH0637