Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K), Unconjugated, E. coli

Artikelnummer: BIM-RPC23575
Artikelname: Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K), Unconjugated, E. coli
Artikelnummer: BIM-RPC23575
Hersteller Artikelnummer: RPC23575
Alternativnummer: BIM-RPC23575-20UG,BIM-RPC23575-100UG,BIM-RPC23575-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Eukaryotic translation initiation factor 3 subunit 12Muscle-specific gene M9 proteinPLAC-24eIF-3 p25eIF-3 p28EIF3S12
Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: EIF3K. Target Synonyms: Eukaryotic translation initiation factor 3 subunit 12Muscle-specific gene M9 proteinPLAC-24eIF-3 p25eIF-3 p28EIF3S12. Accession Number: Q9UBQ5. Expression Region: 2~218aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 51.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 51.9kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
Target-Kategorie: EIF3K