Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K), Unconjugated, E. coli

Catalog Number: BIM-RPC23575
Article Name: Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23575
Supplier Catalog Number: RPC23575
Alternative Catalog Number: BIM-RPC23575-20UG,BIM-RPC23575-100UG,BIM-RPC23575-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Eukaryotic translation initiation factor 3 subunit 12Muscle-specific gene M9 proteinPLAC-24eIF-3 p25eIF-3 p28EIF3S12
Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: EIF3K. Target Synonyms: Eukaryotic translation initiation factor 3 subunit 12Muscle-specific gene M9 proteinPLAC-24eIF-3 p25eIF-3 p28EIF3S12. Accession Number: Q9UBQ5. Expression Region: 2~218aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 51.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 51.9kDa
Tag: N-Terminal Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
Target: EIF3K