Recombinant Human E3 ubiquitin-protein ligase TRAIP (TRAIP), Unconjugated, E. coli

Artikelnummer: BIM-RPC23581
Artikelname: Recombinant Human E3 ubiquitin-protein ligase TRAIP (TRAIP), Unconjugated, E. coli
Artikelnummer: BIM-RPC23581
Hersteller Artikelnummer: RPC23581
Alternativnummer: BIM-RPC23581-20UG,BIM-RPC23581-100UG,BIM-RPC23581-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: RING finger protein 206RING-type E3 ubiquitin transferase TRAIPCuratedTRAF-interacting proteinRNF206, TRIP
Recombinant Human E3 ubiquitin-protein ligase TRAIP (TRAIP) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TRAIP. Target Synonyms: RING finger protein 206RING-type E3 ubiquitin transferase TRAIPCuratedTRAF-interacting proteinRNF206, TRIP. Accession Number: Q9BWF2. Expression Region: 1~469aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 58.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 58.8kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQK
Target-Kategorie: TRAIP