Recombinant Human E3 ubiquitin-protein ligase TRAIP (TRAIP), Unconjugated, E. coli

Catalog Number: BIM-RPC23581
Article Name: Recombinant Human E3 ubiquitin-protein ligase TRAIP (TRAIP), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23581
Supplier Catalog Number: RPC23581
Alternative Catalog Number: BIM-RPC23581-20UG,BIM-RPC23581-100UG,BIM-RPC23581-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: RING finger protein 206RING-type E3 ubiquitin transferase TRAIPCuratedTRAF-interacting proteinRNF206, TRIP
Recombinant Human E3 ubiquitin-protein ligase TRAIP (TRAIP) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TRAIP. Target Synonyms: RING finger protein 206RING-type E3 ubiquitin transferase TRAIPCuratedTRAF-interacting proteinRNF206, TRIP. Accession Number: Q9BWF2. Expression Region: 1~469aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 58.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 58.8kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQK
Target: TRAIP