Recombinant Mouse Matrix metalloproteinase-24 (Mmp24), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC23658
Artikelname: Recombinant Mouse Matrix metalloproteinase-24 (Mmp24), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC23658
Hersteller Artikelnummer: RPC23658
Alternativnummer: BIM-RPC23658-20UG,BIM-RPC23658-100UG,BIM-RPC23658-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Matrix metalloproteinase-21MMP-21Membrane-type matrix metalloproteinase 5MT-MMP 5MTMMP5Membrane-type-5 matrix metalloproteinaseMT5-MMPMT5MMPMmp21, Mt5mmp
Recombinant Mouse Matrix metalloproteinase-24 (Mmp24), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Mmp24. Target Synonyms: Matrix metalloproteinase-21MMP-21Membrane-type matrix metalloproteinase 5MT-MMP 5MTMMP5Membrane-type-5 matrix metalloproteinaseMT5-MMPMT5MMPMmp21, Mt5mmp. Accession Number: Q9R0S2. Expression Region: 42~575aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 66.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 66.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AGKPAGADAPFAGQNWLKSYGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQ
Target-Kategorie: Mmp24