Recombinant Mouse Matrix metalloproteinase-24 (Mmp24), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC23658
Article Name: Recombinant Mouse Matrix metalloproteinase-24 (Mmp24), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23658
Supplier Catalog Number: RPC23658
Alternative Catalog Number: BIM-RPC23658-20UG,BIM-RPC23658-100UG,BIM-RPC23658-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Matrix metalloproteinase-21MMP-21Membrane-type matrix metalloproteinase 5MT-MMP 5MTMMP5Membrane-type-5 matrix metalloproteinaseMT5-MMPMT5MMPMmp21, Mt5mmp
Recombinant Mouse Matrix metalloproteinase-24 (Mmp24), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Mmp24. Target Synonyms: Matrix metalloproteinase-21MMP-21Membrane-type matrix metalloproteinase 5MT-MMP 5MTMMP5Membrane-type-5 matrix metalloproteinaseMT5-MMPMT5MMPMmp21, Mt5mmp. Accession Number: Q9R0S2. Expression Region: 42~575aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 66.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 66.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: AGKPAGADAPFAGQNWLKSYGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQ
Target: Mmp24