Recombinant Human Group IID secretory phospholipase A2 (PLA2G2D), partial, Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Human Group IID secretory phospholipase A2 (PLA2G2D), partial, Unconjugated, E. coli
• Artikelnummer: BIM-RPC23742
• Hersteller Artikelnummer: RPC23742
• Alternativnummer: BIM-RPC23742-20UG,BIM-RPC23742-100UG,BIM-RPC23742-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: PLA2IIDPhosphatidylcholine 2-acylhydrolase 2DSecretory-type PLA, stroma-associated homolog

Produktbeschreibung

Accession Number: Q9UNK4. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 22~145aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Metabolism. Shipping Condition: Ice packs. Short Description: Recombinant Human Group IID secretory phospholipase A2 (PLA2G2D), partial is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 30.5kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% by SDS-PAGE
• Sequenz: ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
• Target-Kategorie: PLA2G2D