Recombinant Human Group IID secretory phospholipase A2 (PLA2G2D), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human Group IID secretory phospholipase A2 (PLA2G2D), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC23742
• Supplier Catalog Number: RPC23742
• Alternative Catalog Number: BIM-RPC23742-20UG,BIM-RPC23742-100UG,BIM-RPC23742-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: PLA2IIDPhosphatidylcholine 2-acylhydrolase 2DSecretory-type PLA, stroma-associated homolog

Product Description

Accession Number: Q9UNK4. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 22~145aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Metabolism. Shipping Condition: Ice packs. Short Description: Recombinant Human Group IID secretory phospholipase A2 (PLA2G2D), partial is a purified Recombinant Protein

Product Properties

• Molecular Weight: 30.5kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
• Target: PLA2G2D