Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Active Protein, Unconjugated, Yeast

Artikelnummer: BIM-RPC24995
Artikelname: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Active Protein, Unconjugated, Yeast
Artikelnummer: BIM-RPC24995
Hersteller Artikelnummer: RPC24995
Alternativnummer: BIM-RPC24995-20UG,BIM-RPC24995-100UG,BIM-RPC24995-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Active Protein is a purified Active Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TMPRSS2. Accession Number: O15393. Expression Region: 106~492aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 44.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
Target-Kategorie: TMPRSS2