Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Active Protein, Unconjugated, Yeast

Catalog Number: BIM-RPC24995
Article Name: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Active Protein, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC24995
Supplier Catalog Number: RPC24995
Alternative Catalog Number: BIM-RPC24995-20UG,BIM-RPC24995-100UG,BIM-RPC24995-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Active Protein is a purified Active Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TMPRSS2. Accession Number: O15393. Expression Region: 106~492aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 44.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
Target: TMPRSS2