Recombinant Mouse Thioredoxin-interacting protein (Txnip), Unconjugated, Yeast

Artikelnummer: BIM-RPC25446
Artikelname: Recombinant Mouse Thioredoxin-interacting protein (Txnip), Unconjugated, Yeast
Artikelnummer: BIM-RPC25446
Hersteller Artikelnummer: RPC25446
Alternativnummer: BIM-RPC25446-20UG,BIM-RPC25446-100UG,BIM-RPC25446-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Vitamin D3 up-regulated protein 1
Accession Number: Q8BG60. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1~397aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Thioredoxin-interacting protein (Txnip) is a purified Recombinant Protein
Molekulargewicht: 46.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTLDYLRYEDTLLLEEQPTAGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQEAKKNFEVMDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVFTQKLSSVRGNHIISGTCASWRGK
Target-Kategorie: Txnip