Recombinant Mouse Thioredoxin-interacting protein (Txnip), Unconjugated, Yeast

Product Overview

• Article Name: Recombinant Mouse Thioredoxin-interacting protein (Txnip), Unconjugated, Yeast
• Biozol Catalog Number: BIM-RPC25446
• Supplier Catalog Number: RPC25446
• Alternative Catalog Number: BIM-RPC25446-20UG,BIM-RPC25446-100UG,BIM-RPC25446-1MG
• Manufacturer: Biomatik Corporation
• Host: Yeast
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Conjugation: Unconjugated
• Alternative Names: Vitamin D3 up-regulated protein 1

Product Description

Accession Number: Q8BG60. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1~397aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Thioredoxin-interacting protein (Txnip) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 46.4kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTLDYLRYEDTLLLEEQPTAGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQEAKKNFEVMDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVFTQKLSSVRGNHIISGTCASWRGK
• Target: Txnip