Recombinant Staphylococcus epidermidis Endoribonuclease MazF (mazF), Unconjugated, E. coli

Artikelnummer: BIM-RPC25705
Artikelname: Recombinant Staphylococcus epidermidis Endoribonuclease MazF (mazF), Unconjugated, E. coli
Artikelnummer: BIM-RPC25705
Hersteller Artikelnummer: RPC25705
Alternativnummer: BIM-RPC25705-20UG,BIM-RPC25705-100UG,BIM-RPC25705-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Toxin MazF (mRNA interferase MazF)
Recombinant Staphylococcus epidermidis Endoribonuclease MazF (mazF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus epidermidis. Target Name: mazF. Target Synonyms: Toxin MazF (mRNA interferase MazF). Accession Number: Q9F7V5. Expression Region: 1~120aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 19.0kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITDGINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Target-Kategorie: mazF