Recombinant Staphylococcus epidermidis Endoribonuclease MazF (mazF), Unconjugated, E. coli

Catalog Number: BIM-RPC25705
Article Name: Recombinant Staphylococcus epidermidis Endoribonuclease MazF (mazF), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25705
Supplier Catalog Number: RPC25705
Alternative Catalog Number: BIM-RPC25705-20UG,BIM-RPC25705-100UG,BIM-RPC25705-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Toxin MazF (mRNA interferase MazF)
Recombinant Staphylococcus epidermidis Endoribonuclease MazF (mazF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus epidermidis. Target Name: mazF. Target Synonyms: Toxin MazF (mRNA interferase MazF). Accession Number: Q9F7V5. Expression Region: 1~120aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.0kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITDGINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Target: mazF