Recombinant Pig Rhodopsin (RHO), partial, Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Pig Rhodopsin (RHO), partial, Unconjugated, E. coli
• Artikelnummer: BIM-RPC25714
• Hersteller Artikelnummer: RPC25714
• Alternativnummer: BIM-RPC25714-20UG,BIM-RPC25714-100UG,BIM-RPC25714-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Porcine
• Konjugation: Unconjugated
• Alternative Synonym: RHO1

Produktbeschreibung

Recombinant Pig Rhodopsin (RHO), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: RHO. Target Synonyms: RHO1. Accession Number: O18766. Expression Region: 1~36aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 31.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Produkteigenschaften

• Molekulargewicht: 31.2kDa
• Tag: N-Terminal Gst-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >85% by SDS-PAGE
• Sequenz: MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ
• Target-Kategorie: RHO