Recombinant Pig Rhodopsin (RHO), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Pig Rhodopsin (RHO), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC25714
• Supplier Catalog Number: RPC25714
• Alternative Catalog Number: BIM-RPC25714-20UG,BIM-RPC25714-100UG,BIM-RPC25714-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Porcine
• Conjugation: Unconjugated
• Alternative Names: RHO1

Product Description

Recombinant Pig Rhodopsin (RHO), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: RHO. Target Synonyms: RHO1. Accession Number: O18766. Expression Region: 1~36aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 31.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 31.2kDa
• Tag: N-Terminal Gst-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >85% by SDS-PAGE
• Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ
• Target: RHO