Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial, Unconjugated, Virus

Produktübersicht

• Artikelname: Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial, Unconjugated, Virus
• Artikelnummer: BIM-RPC27234
• Hersteller Artikelnummer: RPC27234
• Alternativnummer: BIM-RPC27234-20UG,BIM-RPC27234-100UG,BIM-RPC27234-1MG
• Hersteller: Biomatik Corporation
• Wirt: Virus
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Virus
• Konjugation: Unconjugated
• Alternative Synonym: E2, Peplomer protein

Produktbeschreibung

Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial is a purified Recombinant Protein, Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human coronavirus OC43 (HCoV-OC43). Target Name: S. Target Synonyms: E2, Peplomer protein. Accession Number: P36334. Expression Region: 15~344aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 41.5kDa. Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Produkteigenschaften

• Molekulargewicht: 41.5kDa
• Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
• Puffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reinheit: >85% by SDS-PAGE
• Formulierung: Lyophilized powder
• Sequenz: VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPL
• Target-Kategorie: S