Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial, Unconjugated, Virus

Product Overview

• Article Name: Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial, Unconjugated, Virus
• Biozol Catalog Number: BIM-RPC27234
• Supplier Catalog Number: RPC27234
• Alternative Catalog Number: BIM-RPC27234-20UG,BIM-RPC27234-100UG,BIM-RPC27234-1MG
• Manufacturer: Biomatik Corporation
• Host: Virus
• Category: Proteine/Peptide
• Species Reactivity: Virus
• Conjugation: Unconjugated
• Alternative Names: E2, Peplomer protein

Product Description

Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial is a purified Recombinant Protein, Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human coronavirus OC43 (HCoV-OC43). Target Name: S. Target Synonyms: E2, Peplomer protein. Accession Number: P36334. Expression Region: 15~344aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 41.5kDa. Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 41.5kDa
• Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
• Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Purity: >85% by SDS-PAGE
• Form: Lyophilized powder
• Sequence: VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPL
• Target: S