Recombinant Solanum melongena Anthocyanidin 3-O-glucosyltransferase (GT), Unconjugated, Virus

Artikelnummer: BIM-RPC27237
Artikelname: Recombinant Solanum melongena Anthocyanidin 3-O-glucosyltransferase (GT), Unconjugated, Virus
Artikelnummer: BIM-RPC27237
Hersteller Artikelnummer: RPC27237
Alternativnummer: BIM-RPC27237-20UG,BIM-RPC27237-100UG,BIM-RPC27237-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Flavonol 3-O-glucosyltransferase (UDP-glucose flavonoid 3-O-glucosyltransferase)
Recombinant Solanum melongena Anthocyanidin 3-O-glucosyltransferase (GT) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Solanum melongena (Eggplant) (Aubergine). Target Name: GT. Target Synonyms: Flavonol 3-O-glucosyltransferase (UDP-glucose flavonoid 3-O-glucosyltransferase). Accession Number: Q43641. Expression Region: 1~433aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 52.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 52.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MTTSQLHIAFLAFPFGTHATPLLTLVQKISPFLPSSTIFSFFNTSSSNSSIFSKVPNQENIKIYNVWDGVKEGNDTPFGLEAIKLFIQSTLLISKITEEAEEETGVKFSCIFSDAFLWCFLVKLPKKMNAPGVAYWTGGSCSLAVHLYTDLIRSNKETSLKIPGFSSTLSINDIPPEVTAEDLEGPMSSMLYNMALNLHKADAVVLNSFQELDRDPLINKDLQKNLQKVFNIGPLVLQSSRKLDESGCIQWLDKQ
Target-Kategorie: GT