Recombinant Solanum melongena Anthocyanidin 3-O-glucosyltransferase (GT), Unconjugated, Virus

Catalog Number: BIM-RPC27237
Article Name: Recombinant Solanum melongena Anthocyanidin 3-O-glucosyltransferase (GT), Unconjugated, Virus
Biozol Catalog Number: BIM-RPC27237
Supplier Catalog Number: RPC27237
Alternative Catalog Number: BIM-RPC27237-20UG,BIM-RPC27237-100UG,BIM-RPC27237-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Flavonol 3-O-glucosyltransferase (UDP-glucose flavonoid 3-O-glucosyltransferase)
Recombinant Solanum melongena Anthocyanidin 3-O-glucosyltransferase (GT) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Solanum melongena (Eggplant) (Aubergine). Target Name: GT. Target Synonyms: Flavonol 3-O-glucosyltransferase (UDP-glucose flavonoid 3-O-glucosyltransferase). Accession Number: Q43641. Expression Region: 1~433aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 52.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 52.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MTTSQLHIAFLAFPFGTHATPLLTLVQKISPFLPSSTIFSFFNTSSSNSSIFSKVPNQENIKIYNVWDGVKEGNDTPFGLEAIKLFIQSTLLISKITEEAEEETGVKFSCIFSDAFLWCFLVKLPKKMNAPGVAYWTGGSCSLAVHLYTDLIRSNKETSLKIPGFSSTLSINDIPPEVTAEDLEGPMSSMLYNMALNLHKADAVVLNSFQELDRDPLINKDLQKNLQKVFNIGPLVLQSSRKLDESGCIQWLDKQ
Target: GT