Recombinant Human SH3 and PX domain-containing protein 2A (SH3PXD2A), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC28287
Artikelname: Recombinant Human SH3 and PX domain-containing protein 2A (SH3PXD2A), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC28287
Hersteller Artikelnummer: RPC28287
Alternativnummer: BIM-RPC28287-20UG,BIM-RPC28287-100UG,BIM-RPC28287-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Adapter protein TKS5 (Five SH3 domain-containing protein, SH3 multiple domains protein 1, Tyrosine kinase substrate with five SH3 domains FISH, KIAA0418, SH3MD1, TKS5)
Recombinant Human SH3 and PX domain-containing protein 2A (SH3PXD2A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SH3PXD2A. Target Synonyms: Adapter protein TKS5 (Five SH3 domain-containing protein, SH3 multiple domains protein 1, Tyrosine kinase substrate with five SH3 domains FISH, KIAA0418, SH3MD1, TKS5). Accession Number: Q5TCZ1. Expression Region: 902~986aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 14.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 14.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP
Target-Kategorie: SH3PXD2A