Recombinant Human SH3 and PX domain-containing protein 2A (SH3PXD2A), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC28287
Article Name: Recombinant Human SH3 and PX domain-containing protein 2A (SH3PXD2A), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC28287
Supplier Catalog Number: RPC28287
Alternative Catalog Number: BIM-RPC28287-20UG,BIM-RPC28287-100UG,BIM-RPC28287-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Adapter protein TKS5 (Five SH3 domain-containing protein, SH3 multiple domains protein 1, Tyrosine kinase substrate with five SH3 domains FISH, KIAA0418, SH3MD1, TKS5)
Recombinant Human SH3 and PX domain-containing protein 2A (SH3PXD2A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SH3PXD2A. Target Synonyms: Adapter protein TKS5 (Five SH3 domain-containing protein, SH3 multiple domains protein 1, Tyrosine kinase substrate with five SH3 domains FISH, KIAA0418, SH3MD1, TKS5). Accession Number: Q5TCZ1. Expression Region: 902~986aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 14.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 14.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP
Target: SH3PXD2A